SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019173 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019173
Domain Number 1 Region: 512-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-17
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 553-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000985
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 470-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000035
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019173   Gene: ENSBTAG00000014415   Transcript: ENSBTAT00000019173
Sequence length 618
Comment pep:known chromosome:UMD3.1:7:17069809:17085059:-1 gene:ENSBTAG00000014415 transcript:ENSBTAT00000019173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERAPEPEAEAEAEAGAGGEAAAEESAAGRKARGRPRLTESDRARRRLESRKKYDVRRV
YLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNV
NCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDS
DPESDKVGNGLVAGSSDSSSSGSGSDSEEPPEGQPTKATVATAAVTPTSPAGSSGLITQE
GMHIPFDVHHVESLAEQGNPLCPNPASSGPEALETVVCVPVPVQVGPGPGTLFENVPQEA
LGEVVASCPMPGMVPGSQVIIIAGPGYDALTAEGIHLNMAAGSSAPGGGLGDEVPCAMME
GVAAYTQTEPEGGPPSTMDPAAMTGIETKKEKEDLCVLKKEEKEELVAPEMAELAATVPE
SAEPDAEADGEELEGSDMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQV
YVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSF
KRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCERCGKRFEK
LDSVKFHTLKSHPDHKPA
Download sequence
Identical sequences E1B9B2
XP_002688894.1.76553 XP_015319572.1.59421 ENSBTAP00000019173 ENSBTAP00000019173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]