SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019237 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019237
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily SNARE-like 4.3e-44
Family Clathrin coat assembly domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019237   Gene: ENSBTAG00000014468   Transcript: ENSBTAT00000019237
Sequence length 157
Comment pep:known chromosome:UMD3.1:25:36180839:36185662:-1 gene:ENSBTAG00000014468 transcript:ENSBTAT00000019237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKR
YASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGG
DVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Download sequence
Identical sequences A0A091EIX5 A0A1U7T1M9 A0A2I2UW94 A0A2K5UQD2 G3S7P4 Q1JQ98
ENSMICP00000004923 NP_001070578.1.59421 NP_001070578.1.76553 XP_004666349.1.11716 XP_005549343.1.63531 XP_006047361.1.26621 XP_006180978.1.101512 XP_007073969.1.5354 XP_007622407.1.28591 XP_008016667.1.81039 XP_008016668.1.81039 XP_008047761.1.4292 XP_008696740.1.72690 XP_010817909.1.76553 XP_011369899.1.92234 XP_011758271.1.29376 XP_011815416.1.43180 XP_011815417.1.43180 XP_011840594.1.47321 XP_014332821.1.15283 XP_015450163.1.64745 XP_016001979.1.101085 XP_017513846.1.32401 XP_018886659.1.27298 XP_020029277.1.5219 XP_021519758.1.76796 ENSMICP00000004923 ENSBTAP00000019237 ENSPTRP00000033422 ENSBTAP00000019237 ENSNLEP00000010005 9598.ENSPTRP00000033422 ENSPTRP00000033422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]