SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019345 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019345
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 151-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000139
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 221-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000631
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019345   Gene: ENSBTAG00000014554   Transcript: ENSBTAT00000019345
Sequence length 264
Comment pep:known chromosome:UMD3.1:13:78766068:78772194:1 gene:ENSBTAG00000014554 transcript:ENSBTAT00000019345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVRKSAGSRRRPNYSELHDSSPELTFQQPYDQAHLLAAIPPPEVLNPTASLPTLI
WDSLLAPQAQPISWASLLPQEIPKAGELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSASS
LEAEGYAAFPGLGQLPKQLTGLSVAKDPQSRKAFNCKYCNKEYISLGALKMHIRSHTLPC
VCSTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKT
CSRTFSRMSLLHKHQESGCSGGPR
Download sequence
Identical sequences E1BMI0 L8IAS1
9913.ENSBTAP00000019345 NP_001106179.1.59421 NP_001106179.1.76553 XP_005899690.1.15283 XP_006048397.1.26621 XP_010833393.1.44457 XP_019828128.1.53367 ENSBTAP00000019345 ENSBTAP00000019345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]