SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019429 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019429
Domain Number 1 Region: 76-156
Classification Level Classification E-value
Superfamily EF-hand 1.94e-18
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019429   Gene: ENSBTAG00000014596   Transcript: ENSBTAT00000019429
Sequence length 236
Comment pep:known chromosome:UMD3.1:3:113006125:113050192:1 gene:ENSBTAG00000014596 transcript:ENSBTAT00000019429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEELASKLQRRLQWEEGDSGLQPAPGAAPDPEPQPQPPAWAPTARADAELSAQLNRRL
DINEGAARPRRCKVFHPYSEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLG
APQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALE
GVKGAKDFFEAKVQALSCASKFEAELKAEQDERKREEEKRKVRQAAFRELKAAFSA
Download sequence
Identical sequences Q17QM6
ENSBTAP00000019429 NP_001069300.1.59421 NP_001069300.1.76553 XP_019813477.1.53367 ENSBTAP00000019429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]