SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019646 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019646
Domain Number 1 Region: 580-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 497-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-19
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 4 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 621-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-16
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 407-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000254
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 359-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000842
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 543-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000677
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019646   Gene: ENSBTAG00000014768   Transcript: ENSBTAT00000019646
Sequence length 705
Comment pep:known chromosome:UMD3.1:4:113021969:113030533:-1 gene:ENSBTAG00000014768 transcript:ENSBTAT00000019646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAELPLTFEDVAIYFSEQEWQNLEAWQKELYKQVMRANYEILLSLDNGLPKPELISWIEQ
GRELFKKWGESQESRNIICSAADLHFDPLIEGQPFSENQQAVSSEEAHYYFQVDPLQSHR
SCKPLSEKSEDVSFRPDQAVALVNPQRPNTWALLPAVHSSREPTQRDKIASPRALGIPGF
QKTASGEGLQQSCAFCGESFWNEDLLEWHQGSHSKAWKQLSKQPEAQQLRSQTHFRCPGC
GRGFRRKPHLLSPLAVRAEESRPLGLESEETCGHRVTPPRPSPYPGCDEGASRGPPGMER
PVSPREGAGAASEQDELPPSSNLAGQKCGRWAGGPEALKPGPGGERPSSYGACSRRPSQR
CRLSDHTHVHRAERPCRCAECGRAFRQRGRLRLHRQPPSHEPPCTGPECGLGFRLRSALQ
AHGLRHGGERPLACDECGRGFAHPCKLREHLRVHSGERPFCCAECGKSFRLKGILKAHER
THSRERPFQCAECGRGFTRPSKLAEHFRVHSGERPFSCVDCGRRFRLQGQLRSHRRLHTG
ERPFPCPDCGKSYRVKADLKAHQLLHGGPMPFSCECGKGFAKQSKLVEHVRTHTGEKPFQ
CPQCDKRFRLKAQLLSHQGLHTGERPFRCPECDKNFRERGHMLRHQRIHRPDRPFACADC
GKGFIYKSKLAEHVRVHTKSCRVRREPDVKKRLSQLFEMIEADWS
Download sequence
Identical sequences E1BNL8
ENSBTAP00000019646 ENSBTAP00000019646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]