SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019648 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019648
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 3.49e-30
Family SAND domain 0.0000102
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000019648
Domain Number - Region: 248-344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019648   Gene: ENSBTAG00000014769   Transcript: ENSBTAT00000019648
Sequence length 536
Comment pep:known chromosome:UMD3.1:13:54573252:54583251:1 gene:ENSBTAG00000014769 transcript:ENSBTAT00000019648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDTAADGSGVEEVKTVLVTTNLAPHGGDLMEDNMDTENAAAA
AAAAFTASSQLKEAMLVKMAEEEESLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDRVCSNTCRSTKI
DLSGARASLGSPTPTEYIPLTPATADVNGAPATITIETCEDPGDWTTAVGDDTFAFWRGL
KDAGLLDEVIQEFHQELVETMKGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPR
LARATSGPAAIASQVLAQSAQIALTPGVPVSQLTSVPLGKVVSTLPSPVLGKAAPQVAPA
SSPASPLLGGYTVLASSGTTFPNTVEIHPDASSLTVLSTAAMQDGSTVVKVVSPLQLLTL
PGLGPTLQNVAQVSPGGSTIVTVPTGTVESAVAAPGPEEHTATIEVAAMAEGHEHK
Download sequence
Identical sequences E1BNL6
9913.ENSBTAP00000019648 NP_001179105.1.59421 NP_001179105.1.76553 XP_005214680.1.76553 ENSBTAP00000019648 ENSBTAP00000019648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]