SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019675 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019675
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily POZ domain 9.81e-23
Family BTB/POZ domain 0.0078
Further Details:      
 
Domain Number 2 Region: 360-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000092
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 250-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000624
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 444-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000364
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019675   Gene: ENSBTAG00000014790   Transcript: ENSBTAT00000019675
Sequence length 514
Comment pep:known chromosome:UMD3.1:9:89576712:89603963:-1 gene:ENSBTAG00000014790 transcript:ENSBTAT00000019675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSEC
VRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFS
HPDQVFPLASSLYGIQIADHQLRQATKITSAPEKLGREPRPQATRMSQEQGPEASQLSQL
PSNLSQVNRTHMTPSDPLQTSLSPDLVSTPVPPPPPGEETNLEASSSDEQPAPLTIAHVK
PSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTASQPGESRVPLSLCSNAA
DLGKDAMEVPEAGIISDSELQHISDSPIIDGQPHSETPPPSDIADIDNLEQADQEREVKR
RKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM
VDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALEE
GRSILLGSGDSEVTEPDHPVLASIKKEQETVLLD
Download sequence
Identical sequences E1BNH4 L8ITM0
ENSBTAP00000019675 ENSBTAP00000019675 NP_001192697.1.59421 NP_001192697.1.76553 XP_005211105.1.76553 XP_005211106.1.76553 XP_005891601.1.15283 XP_006080270.1.26621 XP_010839126.1.44457 XP_019823157.1.53367 9913.ENSBTAP00000019675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]