SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019691 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019691
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily SNARE-like 3.66e-34
Family Synatpobrevin N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019691   Gene: ENSBTAG00000014797   Transcript: ENSBTAT00000019691
Sequence length 306
Comment pep:known chromosome:UMD3.1:1:68170572:68232640:1 gene:ENSBTAG00000014797 transcript:ENSBTAT00000019691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMILSASVIRVRDGLPLSASTDYEQGTGMQECRKYFKMLSRKLAQLPDRCTLKTGRYNI
NFISSMGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ
RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQISMGELGSANGVTSAFSVDYKGAGKISS
AHQRLEPATLSGIVAFILSLLCAALNLIRGFHAIESLLQSSGYDLFYLVLSFLKTHTIHF
QIYLLIWIKSWPSVKSFLTFGLICLCMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGK
APDYDV
Download sequence
Identical sequences F1N2T5
ENSBTAP00000019691 ENSBTAP00000019691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]