SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019695 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019695
Domain Number 1 Region: 180-504
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.19e-77
Family Pancreatic carboxypeptidases 0.00000231
Further Details:      
 
Domain Number 2 Region: 41-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.22e-30
Family Frizzled cysteine-rich domain 0.00082
Further Details:      
 
Domain Number 3 Region: 504-582
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.75e-17
Family Carboxypeptidase regulatory domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019695   Gene: ENSBTAG00000014803   Transcript: ENSBTAT00000019695
Sequence length 644
Comment pep:known chromosome:UMD3.1:6:106626199:106650047:1 gene:ENSBTAG00000014803 transcript:ENSBTAT00000019695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPPPLLLTMLVLAAARPGCEPAWDPEGGCPRSAAADSAMCVDLQLQTCSDVTYNRTAF
PTLLQHRSREAVESSSEYILLSVLHHLLEGQCNPDLRLLGCAVLAPRCEGGRVRRPCRHV
CGALREACQPAFDAIDMAWPYFLDCGRYFSGPEEGCYDPLEKLRGGLDIEEALPSGHPPT
FIQFTHHSYAQMVRVLRRTAARCAHISKTYSIGRSFDGRDLLVIEFSSRPGQHELMEPEV
KLIGNIHGNEVAGREMLIYLAQYLCSEYLLGSPRIQRLLNTTRIHLLPSMNPDGYEVAAA
EGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLASVRGARSDHIAIPQHYWWGKVAPET
KAIMKWMRTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDDKMFKLLARAYADV
HPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHSNCFEITVELGCMKFPPE
EALYTIWQHNKEPLLNFMEMVHRGIKGMVMDKFGKPVKNARILVKGIRHDITTAPDGDYW
RLLPPGAHIVIAQAPGYSKVIKKVIIPARMKRAGRVDFILQPLRTGPQKFLPGSRRGGLG
GEPQEPDEEPLGARRQPTTGGSKPWWWSYFTSLGQHQPRWLLKY
Download sequence
Identical sequences F1N2T3
ENSBTAP00000019695 ENSBTAP00000019695 9913.ENSBTAP00000019695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]