SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019746 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019746
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 7.05e-17
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 2 Region: 847-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000102
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 769-802
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000738
Family CCCH zinc finger 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000019746
Domain Number - Region: 905-933
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000115
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 631-661
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 505-533
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019746   Gene: ENSBTAG00000014826   Transcript: ENSBTAT00000019746
Sequence length 972
Comment pep:known chromosome:UMD3.1:25:10496621:10522623:-1 gene:ENSBTAG00000014826 transcript:ENSBTAT00000019746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWN
HSISQYSEALSIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCDTVLSLNA
SNYKALYRKSKALSDLGRFREAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNCSVEDIEPDLLTPRQEALSVVSIPASSFSHQVGNELASISIM
PLTSVLPLQVEESSLPSTVLANGGKMPFGTPEVFLDDGDMVLGDEIDDLLDSAPEANETV
MPSALVRGPLPTASIGPSVPFSAASLLGALPIGARYAPAPSFSELYPPLTSSLEDFCSSL
NSFSMSESKRDLSTSTSREGTALNNSNSSLLLMNGPGSLFASESFLGISSHPRNDFGNFF
GSAVTKPTSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANLDHKCKKDILIGRI
KNVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKG
AFSREAFFGGNGKISFTVFRLFQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTSCSHPVT
KHEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELK
VWILQNETGISHDDIAQESKRYWQNLEANVPGAQVLGNQIMPGSLNMKIKFVCAQCLRNG
QVIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIA
SGKKCQYIGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKSEKSDDAASQSSKE
NGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRF
PTGYFSICDRYMNGTCTEGSSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIAPNDND
FGKYSFLFKDLN
Download sequence
Identical sequences A7Z062 L8IYK2
NP_001098900.1.59421 NP_001098900.1.76553 XP_005889319.1.15283 XP_019843213.1.53367 9913.ENSBTAP00000019746 ENSBTAP00000019746 ENSBTAP00000019746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]