SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019901 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019901
Domain Number 1 Region: 5-268
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019901   Gene: ENSBTAG00000046971   Transcript: ENSBTAT00000019901
Sequence length 282
Comment pep:known chromosome:UMD3.1:11:5754349:5776837:1 gene:ENSBTAG00000046971 transcript:ENSBTAT00000019901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGY
INASFIKIPVGREEFVYIACQGPLPTTVGDFWQMIWEQNSSVIAMMTQEVEGEKIKCQRY
WPNVLGKSTMVSNRLRLALVRVQQLKGFVVRAMTLEDIQTGEVRHVSHLNFTAWPDHDTP
SQPDDLLTFISYMRHVHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDISDLVRC
MRLQRHGMVQTEDQYIFCYQVILYVLTRLQAEEEQKEQPQPL
Download sequence
Identical sequences F1N0A2
ENSBTAP00000019901 ENSBTAP00000019901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]