SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020060 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020060
Domain Number 1 Region: 33-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.75e-44
Family Frizzled cysteine-rich domain 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020060   Gene: ENSBTAG00000015072   Transcript: ENSBTAT00000020060
Sequence length 364
Comment pep:known chromosome:UMD3.1:13:27056507:27057989:-1 gene:ENSBTAG00000015072 transcript:ENSBTAT00000020060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPTLSSVDGDPVAGICYVGNQ
SLDNLLGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLF
TVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVV
GITSGVWVWSGKTLESWRALCTRCCWASKGAGGSLYSDVSTGLTWRSGTASSVSYPKQMP
LSQV
Download sequence
Identical sequences E1BCW7
ENSBTAP00000020060 ENSBTAP00000020060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]