SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020103 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020103
Domain Number 1 Region: 2220-2457
Classification Level Classification E-value
Superfamily Plakin repeat 4.32e-84
Family Plakin repeat 0.000000000523
Further Details:      
 
Domain Number 2 Region: 1978-2213
Classification Level Classification E-value
Superfamily Plakin repeat 2.79e-76
Family Plakin repeat 0.00000235
Further Details:      
 
Domain Number 3 Region: 2531-2571,2628-2822
Classification Level Classification E-value
Superfamily Plakin repeat 3.23e-66
Family Plakin repeat 0.0000000105
Further Details:      
 
Domain Number 4 Region: 846-974,1001-1028
Classification Level Classification E-value
Superfamily Spectrin repeat 7.88e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 5 Region: 336-465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 2470-2524
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000811
Family Plakin repeat 0.0056
Further Details:      
 
Domain Number 7 Region: 199-282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000648
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020103   Gene: ENSBTAG00000015106   Transcript: ENSBTAT00000020103
Sequence length 2889
Comment pep:known chromosome:UMD3.1:23:47670503:47714288:-1 gene:ENSBTAG00000015106 transcript:ENSBTAT00000020103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRMTRAESGPDLRYEMTCGGVGGGGGGGGGGGTSRMYYSRRCTVTD
QNSDGYGQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLARSRELDEC
FAQANDQMEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISGPRVRRASSKGGG
GYTCQSGSGWDEFTKRLTSECLGWMRQQRAEMDMMTWGVDLASVEQHISSHRSIHNTIGD
YRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCE
EEELLYDWSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY
MDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNTP
LQRLLEQIKELEKEREKILEYKRQVQSLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYK
QDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSSKIEQYY
EAILALWNQLYINMKSLVSWHYCMIDIEKIKAMTIAKLKTMRQEDYMKTISDLELHYQEF
IRNSQGSEMFGDDDKRKMQTQFTDAQKHYQTLVIQLPGHPQHQTVTTTEITHLGTCQDVN
HNKVIETNRENDKQEAWMLIELQKIRRQMELCESRMALKNILLADQGSSHHITVKINELK
SVQNDAQAIAQVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCAV
RALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKT
ELQKAQQIHSQTSQQYPLYDLDLGKFSEKVTQLTDRWQRIDKQIDYRLWDLEKQIKQLRN
YRDNYQTFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKI
AELCANSIKDYELQLASYTSGLETLLSIPIKRTVIQSPSGVILQEAADMHARYIELLTRS
GDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECS
QFKAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKAVED
RFDQQKSDYDQLQKARQNEKESLGWQKMESEKAIKEKEFEIERLRVLLQEEGARKREYEN
ELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLK
EEIVRLNDSILQTTEQRRRAEEDALQQKACGSEVLQKKQYLEIELKQVIQQRSEDNARHK
QSLEEAAKTIQDKNKEIERLKTEFQEEAKRRWEYENELAKVRANYDEEIISLKNQFETEI
NITKTTIHQLTLQKEEDTSGYRAQIDTLTRENRSLSEEVKRLKNTLAQNTETLRRVEENV
QQQKATGLEMSQRKQQLEVELRQVTQMRTEESARYKQSLDDAAKTIQDKNKEIDRLKQLI
ETEASQRKCLEDENARLQRAQGELQKAHSSATETISKLKVQEQELLRLRLDYERVSQERT
VRDQDIARFQTSLKELQLQKQKAEEELARLKRAASEDSSKRKKLEEELEGMRRTLKEQAI
KVTSLTQQLEQASIVKKRSEDELRQQRDTLDGHLREKQRTQDELRRLASEVEALRRQLLQ
EQESVRQAQTRNEHFQKAIEDKSRSLNESKIEIERLQSLTESLTKEHLMLEEELRQLRLE
YDDLQRGRSEADHDKNATIAELRNQLQISNNRTLELQGLINDLQRERENLRQEIERFQKQ
ALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEEELSRAKTTLEAESRLK
QRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIE
ERCRRKLEDSSRETQSQLETERCRLQREIDRLKQRPYGSHRETQTEYEWSVDSSKLVFDG
LRKKVTAMQLYECQLIDKATLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASASPKEKYS
LVEAKRKKLITPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYTAE
KAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALA
RGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYMQLRERCRIEPHTGLLLLSVQKRSMSF
QGIRQPVTVSELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQ
KLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLL
SAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDI
AYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKK
KQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYDTFKELCEQECEWEEITITG
SDGSTRVVLVDRKTGSQYDIQDTIDKGLIDRKFFEQYRSGSLSLTQFADMISLKNGVGGG
VGGIVGGGSSTGGGLSDDVFGSSRHETVSKISTISSIKNLTIRSSSLSEPLEESSPIAAI
FDTENLEKISISEGIERGIVDSISGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGLIDQ
DMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVQ
GRISTEEAIRKGYIDGRAAQRLQDTSTYGKILTCPKTKLKISYKDAINRSMVEDVTGLRL
LEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYCY
SFSSSSIGH
Download sequence
Identical sequences E1BKT9
ENSBTAP00000020103 NP_001179297.1.59421 NP_001179297.1.76553 ENSBTAP00000020103 9913.ENSBTAP00000020103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]