SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020345 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020345
Domain Number 1 Region: 1970-2252
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000108
Further Details:      
 
Domain Number 2 Region: 1547-1736
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-17
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 749-829
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000225
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 395-487
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000254
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 5 Region: 925-1009
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000373
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 6 Region: 2-92
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000104
Family Cysteine rich domain 0.068
Further Details:      
 
Domain Number 7 Region: 1455-1535
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000123
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 8 Region: 1101-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000353
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 9 Region: 1013-1092
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000386
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 10 Region: 496-647
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000509
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 11 Region: 1367-1447
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000156
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 12 Region: 1190-1268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000822
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 13 Region: 659-740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000101
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 14 Region: 1277-1368
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000662
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 15 Region: 836-926
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000225
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 16 Region: 317-387
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000225
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number 17 Region: 1735-1793,1846-1876
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000457
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020345   Gene: ENSBTAG00000015296   Transcript: ENSBTAT00000020345
Sequence length 2286
Comment pep:known chromosome:UMD3.1:5:43114782:43239445:1 gene:ENSBTAG00000015296 transcript:ENSBTAT00000020345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTNQNQQWMWTEDGKLLHVKSALCLGISNSSGGPGRAAIFAPCSQAPRWTCYEKEGFLEV
ENASLFLKKQGVRVVVKKGRKYLHSWMKIDVNEEGKPVNESLCSKKAFPLNFKFTLKEYT
TQIHFGSPPPTKNIMYAHQNNREQLRKEIPPRPSPEVLRKTTARTAARIHTHKNNPSNLK
EPKSPSPEPFQPLIWPSETSPPNMSLQVIEETNAKKKKKKPTPSKSGVLILTKGCSSLRL
PTNHAEGSTNDLKKILARPTVRAASECLLCRSTGEFLLGMGLTERNLDSFFSPTNTLLSE
NTRKTGLGEPVRCNFTLTESRVSSRSVSLQWRTLAFPCNFNLTYSSDTSGVAWCHPVRID
NTTYGCNSEDLQAGTIYNFTIMSLDGEKKTMVLQTDPLPPARFEVSKEKTTTTSLHVWWT
PSSGKVTWYEVQLLDDNQKIQTAQIQERASRNEYTFFNLTAGNKYNIAITAVSGDKRSST
MYANGSTVVPSPVKDIGVLAKTNSLLISWSRGSGNVERYQLMLMDKGILVHSIAVDTTFY
TFHGLTPGHLYNVTIVSEAAGLQNYKWKSARTTPMEVSNLKVTNEGTMTSLKVKWQRPSG
NVDFYNITLSYQGTIKQSRTLASQITESQFKDLAPGRLYQVTVSCVSGELSAHRTAVGRT
VPQKVGDLEANSNGSTKSLVVSWSPPAGDWEQYRILLWNDSSVLLNITVGKEETHYVIDD
VGLIPGRRYEIEVTVESGNLKNSTRCQGRTVPLAVLHLRVKHANETSLSVMWQTPAAEWE
RYIVSLIDRDLLFIHKLLPRDAREFTFTNLVPGRKYIATVTSISGDLKNSSLTKGRTVPA
QVTGLRVANQGTTNSLFTNWTQALGDVEFYQVLLIHENVVIKNESVSSETSGYSFHSLKS
GSLYSVVVTTVSGGISSRQVVVEGRTVPSSVSGVTVNNSGRSDYLSISWLPAPGDVDSYV
VTLSHDGRVVQSLVIAKSVGECSFSSLTPGRLYNVTITTRSGKYESHSFSQERTVPNKVQ
GVSISNSARSDYLKVSWVHASGDFDHYEVTIKNKNNFIQTKSVPKSENECIFVKLVPGRL
YSVTVSTKSGQYEASEQGNGRTIPEAVKDLTLKNRSTEDLWVTWTRADGDVDQYEIQLLF
NDMKVFPPFHLVSTATEYRFTSLTPGRKYKILVLTISGDVQQSAFIEGFTVPSVVKNIHV
SPSGATDSLTVNWTPGGGDVDSYVVSAFRQNQMVESQTVLKHISEHTFQRLEAGEQYRIV
IASVSGSQKNQIDVLGRTIPASVQGITADNVYSSHSLIVSWQKAVGMAERYDILLLSENG
ILLSNTSEAATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAQTEGRTVPAAVTNLRITE
NSTRHLSFSWTPSEGELNSYNIFLYNPDRTLKDRALVDPQVQSFSFQNLLQGRMYRMVIV
THSGELSNESFIFGRTVPATVSNLKGSNQNMTDSLWFSWSPAPGDFDFYELILYNPNGTK
KENWKDKDLTQWRFHGLVPGRKYTLCVITHSGDLSNKATGESRTDIAPSPPSLMSFADVT
NTSLAITWKGPPDWTDYDDFELQWFPRDAITVFNPYSNRKSEGRIVHGLRPGRSYQFSVK
TVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMD
TQEVEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDSTITMIDRPPPPPP
HIRVNKKDVLISKSSINFTFNCSWFSDTNGAVKYFTVVVREADGNDELKPEPQHPLPSYL
EYRHNASIRVYQTDYFASKCAESPDSNSKSFNIKLGAEMESLGGKCDPNQQKFCDGPLKP
RTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGVIEGVSAGLFLIGML
VAVVALFICRRKKNKNHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKVNQFEGH
FMKLQADSNYLLSKEYEDLKDVGRNQSCDIALLPENRGKNRYNNILPYDSSRVKLSNVDD
DPCSDYINASYIPGNNFRREYIATQGPLPGTKDDFWKMAWEQNVHNIVMVTQCVEKGRVK
CDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFRICSEEQLDAHRLIRHFHYTVWPDH
GVPESTQSLIQFVRTVRDYINRTPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVD
IYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRD
SGYSRH
Download sequence
Identical sequences E1BFE2
ENSBTAP00000020345 ENSBTAP00000020345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]