SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020376 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020376
Domain Number 1 Region: 900-948
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000179
Family Myb/SANT domain 0.007
Further Details:      
 
Domain Number 2 Region: 1023-1047,1091-1118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000375
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020376   Gene: ENSBTAG00000015321   Transcript: ENSBTAT00000020376
Sequence length 1210
Comment pep:known chromosome:UMD3.1:23:15948727:15988075:-1 gene:ENSBTAG00000015321 transcript:ENSBTAT00000020376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDQQLYKTNHVAHGGENLFYQQPPLGVHGGLNHSYGNTVPGAGMDAPQASPISPHFPQD
TRDGLGLAVGSKNLGQVDTSRQGGWGGHAGPGNHVQLRGNLTNSNMMWGAPAQAEPTDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSA
LRQLLSQKPMEAPAAALPSRYQQASQQPHPGFTGGLSKPALQVGQHPSQGHLYYDYQQPL
AQMPVQGGQSLQAPQMLSQHMQQLQPHQYYPPQQQTHAGQQRVSMQEMQPPPQQQIRPPQ
PQPQPQPRQGSMQIPQYYQSPPMIQPLPEPQQPQMHLQPSSYHRDPHQYTPEQAHAVQLI
QLGSMPQYYYQEPQQPYGHPVYQQSHLPQHQQPEDGQPKTYPGDRQAQAMLSSHGDLGPP
DTGMGDAASSDLNRASSALPHRPLLSPGSIHLNNMGSQHQQLSPSAVWPQMHLPDGRAQP
GSPESSSGQPKGVFGEQFDAKNKLTCSICLKEFKSLPALNGHMRSHGGMRASPSLKQEEG
EKAPAPPPQPQPPLPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPSSQGFANSVAAA
PSARDKPASSMSDDEMPVLVRMTLSPPHSPQGAAPNPPAEIPKKHQPGAAKAEEALRSAP
AEKKKFRHRPEPLFIPPPPSYTPNLAASHSGATLYQSQLRSPRVLGDHLLLDPAHELPPY
TPPPMLSPVRQGSGLFSNVLIAGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNLTVTP
GPGEQTVDVEPRINIGLRFQAEIPELQDVSALAQDTHRATLVWKPWPELENHDLQQRVEN
LLNLCCSSALPGGGTNSEFALHSLFEAKGDVMAALEMLLLRKPVRLKCHPLANYHYAGSD
KWTSLERKLFNKALATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLSEI
IDDCVTSEEDEEVEEEEDPEEDRKSTREEESELPKSPEPPQGPVLAPAEGPPLQALGQPS
GSFICEMPNCGAVFSSRQALNGHARIHGGTNQVTKARGTVPSGKQKPGSAQSGYCSVKSS
PSHSTTSGETDPTTIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQKAAFAAEMAA
TIERTTGPVGPQGLLPLDQLSLIKPIKDVDLLDDDVVQQLGGVMAEAEVVDTGLLLDDQA
SVLLQGDTEL
Download sequence
Identical sequences E1BFC1
ENSBTAP00000020376 ENSBTAP00000020376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]