SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020403 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020403
Domain Number 1 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 143-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.41e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 198-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 524-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 8 Region: 440-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 9 Region: 11-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000248
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 10 Region: 563-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000019
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020403   Gene: ENSBTAG00000015348   Transcript: ENSBTAT00000020403
Sequence length 612
Comment pep:known chromosome:UMD3.1:8:92751543:92762917:1 gene:ENSBTAG00000015348 transcript:ENSBTAT00000020403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSPPPQPKEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKDEEPTVKQEIEEIE
EEMEPQGIIVTRIKSEIDQDPMHRETFELVGRLDKQRGIFLWEIPRESLTQEQRMFRGNT
NIIRKRPNSEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEH
QRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNHCKQSFSQRRSLVKHQRIH
TGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGER
PHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEHQRIHTGERPYQC
KECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQRIHTREKTYSYNETK
ESFDPNGGLVIQQEVYPKEKSYKCDECGKTFSVSAHLVQHQRIHTGEKPYLCTVCGKSFS
RSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHKCDECGKAFSRNSG
LIQHQRIHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEVKIQETHECDACGEAFNCRISL
IQHQKLHATWMQ
Download sequence
Identical sequences A5PJY6
NP_001092583.1.59421 NP_001092583.1.76553 XP_019822213.1.53367 ENSBTAP00000020403 9913.ENSBTAP00000020403 ENSBTAP00000020403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]