SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020424 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020424
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-40
Family Frizzled cysteine-rich domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily TIMP-like 5.49e-18
Family Netrin-like domain (NTR/C345C module) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020424   Gene: ENSBTAG00000015366   Transcript: ENSBTAT00000020424
Sequence length 346
Comment pep:known chromosome:UMD3.1:4:50009882:50020466:-1 gene:ENSBTAG00000015366 transcript:ENSBTAT00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSILTALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPDDVKWIDITPDMMVQERPLDIDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQQRTAQD
KKRTAGRTSRSNAPKPKGKPPAPKPASPKKNIKARSAPKSTNPKQA
Download sequence
Identical sequences Q17QP5
ENSBTAP00000020424 NP_001069232.1.59421 NP_001069232.1.76553 ENSBTAP00000020424 9913.ENSBTAP00000020424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]