SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020545 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020545
Domain Number 1 Region: 733-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000914
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020545   Gene: ENSBTAG00000015462   Transcript: ENSBTAT00000020545
Sequence length 1010
Comment pep:known chromosome:UMD3.1:21:25237608:25254749:1 gene:ENSBTAG00000015462 transcript:ENSBTAT00000020545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPFRLLLGTAVSLSDRRPMAASSHAQECGKHLLYVSEEWNEYQNSKRKDAIGCTLNCSC
QSFKPGKINHRQCEQCRHGWVAHALSKLRIPAMYPTSQVEIVQSNVVFDISSLMLYGTQA
IPVRLKILLDRLFSVLKQDEVLQILHALDWTLQDYIRGYVLQDASGKVLDHWSIMTSEEE
VATLQQFLRFGETKSIVELMAIQEKEEQSVVIPPSTANVDIRAFIESCSHRSASLPTPVD
KGNPSSVHPFENLINNMTFMLPFQFFNPLPPALIGSLPDPYVLEQSQDQSQDPKQEVHGA
FPDSSFLTSSSTPFQVEKDPCLNCPNAVTKKEDSTHFSDSSSYSIVTKLERTQLSPEAKV
KPERNSLGAKKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRN
RHSANPNPRLHMPMNRNNRDKDLRSGLTLAASESAKRPGLGVTPPDCRPLPGYAGAVEDS
RSQPTFPSLSHNGVLFPNLKTVQPVLPFYRSPATPAELANTPGMLPSLPLLSSSIPEQLA
SNEMPFDTLPKKKSRKSSMPIKIEKETMETADEKRQPLSSDEDMPLQVVSEDDLETCSPR
SDGAPEELHTPAGSSERPRLEEESPCYLGPGVESSGAIRQTPEQAMHNSERETGQKSVLN
TVPRDAEEDGREPHLTTRVEPCVPFPDYIKLQQHLLAGGLFGALSTQGMAFPCFEDSKEP
EHLGQPASVRSKEENRFQCDICKKTFKNACGVKMHQKNMHSREMHTCTVEGCKASFPSRR
SRDRHSSNLNLHQKVLPQEALESGEDPFRAAYLLKDTAQEAYQEAAFTPQASQTSVIFKG
MSRMGSLVYPLAQVRSAGLQSYASGLPSEGTVLDLSTTSSVKSESSSHSSWDSDGASEEG
AVLTEDCDGTCDGPGLVPGEDYPLCVLMGKADQSLASLPSGLPLTCHLCQKTYSNKGTFR
AHYKTVHLRQLHKCKVPGCNTMFSSVRSRNRHSQNPNLHRSLTSSPSHLR
Download sequence
Identical sequences F1MKA8
ENSBTAP00000020545 ENSBTAP00000020545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]