SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020595 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020595
Domain Number 1 Region: 325-500
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0091
Further Details:      
 
Domain Number 2 Region: 475-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.62e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020595   Gene: ENSBTAG00000031852   Transcript: ENSBTAT00000020595
Sequence length 802
Comment pep:known chromosome:UMD3.1:25:26801396:26811293:-1 gene:ENSBTAG00000031852 transcript:ENSBTAT00000020595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGPAPLVAPPRRHGAPAAPSPPPRGSRAGPVLVVAPGPPVTTATSAPVTLVAPGEARP
AWVPGLTQTSDSVPGPTVTASTEVGLTLEASPDAPRAQVSGPEPLVPEAVAGAEMSVPQA
PGADPPKTEEAITSPDPGPGTLTRTPSRTAPGALTAKPPLAPKPGTTVASGVTARIAAVT
AGQVTSGHGAAAATSASTGQAPEDPSGPGTGPPGTCEAQVAVVTVTPAPEPAENSQDLGS
MSSLGPGISGPRGQAPDTLSYLDSVSLMSGTLESLADDVSSMGSDSEINGLALRKTDKYG
FLGGSQYSGSLESSIPVDVARQRELKWLEMFSHWDKWLSRRFQKVKLRCRKGIPSSLRAK
AWQYLSNSKELLEQNPGKFEELERAPGDPKWLDVIEKDLHRQFPFHEMFAARGGHGQQDL
YRILKAYTIYRPDEGYCQAQAPVAAVLLMHMPAEQAFWCLVQICDKYLPGYYSAGLEAIQ
LDGEIFFALLRRASPLAHRHLRRQRIDPVLYMTEWFMCIFARTLPWASVLRVWDMFFCEG
VKIIFRVALVLLRHTLGSVEKLRSCQGMYETMEQLRNLPQQCMQEDFLVHEVTNLQVTEA
LIERENAAQLKKWLETRGELQYRPSRRLHGSRAIHEERRRQLPPLGPSSSLLSLPGLKSR
GSRAGGGVPSPPPPVRRASAGPAPGPVVTAEGLRPSLPSPTGNSAPLAPSSKEARRQEKE
RQKQEKEREKERQKQEKEREKQEKERQKQEKEQQKQEKERQKQEKKAQGRKLSLRRKADG
PPTPQDGGDRSSASEARQDAYF
Download sequence
Identical sequences F1MJZ7
NP_001192700.1.59421 NP_001192700.1.76553 ENSBTAP00000020595 ENSBTAP00000020595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]