SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020613 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020613
Domain Number 1 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-23
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 7 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 690-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 732-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-17
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 12 Region: 177-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000219
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 13 Region: 651-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000105
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020613   Gene: ENSBTAG00000033642   Transcript: ENSBTAT00000020613
Sequence length 795
Comment pep:known chromosome:UMD3.1:18:60781779:60803711:1 gene:ENSBTAG00000033642 transcript:ENSBTAT00000020613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSEGRLMFQDVAIDFTQEEWECLDPGQRKLYRDVMVENYRNLASLGLVSKVDLVTFLE
LLKDPRNMRRMETTAIYPAMSPQDTQDLMPKNPALEDVFPKANLGMYQIFHLRNLNLKTD
WEYTRISSIHSKMYNVDDNGRDAIQTSLFNTYCGMVNTQQLSMYNKDAVQNPQEENKCKI
CEKVFSKSSNLSRHRRIHTGRKPFKCTECSRAFNCHSLLTQHQRIHAGEKPYICKECNKA
FRRSSFLTQHQRIHTGEKPYKCTVCGKAFTYNSVLIKHQQIHTGEKPYKCTECSKAFTYN
SYLIQHQRIHAGEKPYKCTECSKAFTYNSCLTEHQRIHTGEKPYKCTECSKAFTYNSLLI
QHRRIHTGEKPYKCSECSRAFTCNSDLIEHQRIHTGEKPYICKECNKAFRRSSFLTRHQR
IHAGEKPYKCTVCGKVFTYNSSLIKHRRIHTGEKPYKCTECSKAFTYNSLLIQHQRNHTG
EKPYKCTVCGKAFTYNSRLIKHQRIHAGEKAYKCTECSKAFTYNSLLTQHRRIHTGEKPY
KCTECSKAFTYNSRLIQHRRIHTGEKPYKCTECSKAFTCNTSLTQHQRIHTAEKPYICKE
CNKAFHRSSFLTQHQRIHTGEKPYKCTECGKAFTYHSSLIQHQRIHAGEKPYKCTECSKA
FTYNSLLIRHQHQRIHSGEKSYKCSECGKAFTYNSHLTQHLRIYTGEKPYKCTECSKAFI
CYSDLTYHQEIHTGEKPYKCKECGKAFIRSSALFQHHRIHTGDRRYKCTECRKAFITCYN
LTEYQCVHTGERPYK
Download sequence
Identical sequences F1MJ74
ENSBTAP00000020613 ENSBTAP00000020613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]