SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020989 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020989
Domain Number 1 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 141-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 203-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000432
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000183
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 257-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000231
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 91-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000894
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020989   Gene: ENSBTAG00000022339   Transcript: ENSBTAT00000020989
Sequence length 357
Comment pep:known chromosome:UMD3.1:X:45982171:45983368:1 gene:ENSBTAG00000022339 transcript:ENSBTAT00000020989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLVFEDVAVKLTEEWCLLDSSQRKLYKYVILENFRNLKLVEARQEDHGIEDQFKNQGR
KLESPMIERLSERGENVKLILTLSVKKKTAGFKPWECCACGKFFLSHSSLNRHMSCHIEY
KPREHQKYHEKVYKFKDCGETFFSSSVLRTHKRNHTGEKLNDCEQCGKVFLYEKSLQSHK
NTHTGVKPYECKECRNTLTCRSNVVTHTGDLPFKCKKCEKAFTYPHSLTMNQSSHNGGKP
YQCKQCKKAFKSLKESIHDIIHTREQPCDCKQCGKDFKHFDYERIHTGENTYECKECGKA
FRWRVTFRKHIVTHTGDLPYKCQNCEKAFLYPSYLQTHERNHTGEKPHECEQCGKAF
Download sequence
Identical sequences F1MQ08
ENSBTAP00000020989 ENSBTAP00000020989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]