SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021082 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021082
Domain Number 1 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 655-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 27-87
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 373-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 11 Region: 700-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021082   Gene: ENSBTAG00000032018   Transcript: ENSBTAT00000021082
Sequence length 755
Comment pep:known chromosome:UMD3.1:18:39727958:39736198:1 gene:ENSBTAG00000032018 transcript:ENSBTAT00000021082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNSKPDPELSGKVEWGHQGWETVAIEKEVVTFEDVAVYFTRTEWAGLSPAQRALYRSV
MLEIYRSLTSLGYPVPKPALISLLERGDLPVGLETQDNPPAQGTRDIYKTLSEQQADVGS
LVISKISVVKVYNFQYSFVFAIILRWHFCFLFVISDSRTHMDSELTPTWGISEERDLMMS
HGPQKNVLNKSSFLETCELEQHQEIPTVKNIRGKVLRIHYDRKPFRCEECGKCFSYFSYY
VRHQRIHTGEKPFECNECGKAFNGNSSLIRHQRIHTGEKPYQCEECGRAFNDNANLIRHQ
RIHSGDRPYLCRECGNGFTSSSEFIIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHT
GEKPYECNECGKSFGRTSHLSQHQRIHTGGEKPFKCVECGKSFSYSSHYITHQTIHSGEK
PYQCKVCGKAFSVNGSLSRHQRIHTGERPYQCKECGSSFSCSSAYIIHQRIHTGEKPYEC
NDCGKAFNVNAKLIQHQRIHTGEKPYECTECGRGFRCSSQLRQHQNIHTGERPFQCKECG
KAFSSNAKLIQHQRIHTGEKPYECTECGKAFGVKGKLIQHQRIHTGEKPYECKECGKTFR
CNSQLRQHLRIHTGEKPYECNECGKAFNVNAKLMQHQRIHTGEKPFECNECGKCFTSKRN
LLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSDYIVH
QRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGE
Download sequence
Identical sequences F1MS97
ENSBTAP00000017799 ENSBTAP00000021082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]