SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021091 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021091
Domain Number 1 Region: 24-343
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.24e-112
Family Calpain large subunit, catalytic domain (domain II) 0.0000000818
Further Details:      
 
Domain Number 2 Region: 348-496
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-38
Family Calpain large subunit, middle domain (domain III) 0.0000974
Further Details:      
 
Domain Number 3 Region: 521-672
Classification Level Classification E-value
Superfamily EF-hand 2e-29
Family Penta-EF-hand proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021091   Gene: ENSBTAG00000015865   Transcript: ENSBTAT00000021091
Sequence length 685
Comment pep:known chromosome:UMD3.1:11:68678749:68715047:1 gene:ENSBTAG00000015865 transcript:ENSBTAT00000021091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMCFPICRYWKLGCKDSMGDFSQLPRQDYEALKERCLRDGCLFEDKSFPAALSSIGSGP
LLRKLPSRLQWRRPPELHSNPLFYSAKAKRLDLCQGLVGDCWFLAALQALSLHQDILSRV
VPLNQSFTKKYAGIFQFWFWHFGKWVPIVVDDRLPVNEAGQLVFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQRGQVSEALVDFTGGVTMTIKLSEAPDSLWDVLTRAMYSRTLIGCQTH
CGERVLENGLVDGHAYTLTGLRKVTTRHGPEYLVRLRNPWGKIEWKGDWSDSSSMWDLLS
PKEKILLLRKDDDGEFWMSLQDFKAHFMLLVICKLSPGLLTQEVGQKWSYTMLEGRWENG
RTAGGQMKSPQDTFWKNPQFLLSVWRPQEGKRSQLLCSVLVSLLQKPRHRHRNWKPHLAI
GFYLFRVNQIFDAQKKLPSEFFWKNASLSCRATFLTEKEVSRELWLEPGTYVIVPCTSEA
CQESEFVLRVFSRKHIFYEIGSNSRVIFSKEIVDQSEGKDEFFTKLFEKYPEINAIQLQN
ILNHMPWSGLGSKQPLFSLEACQGILALLDLNASGTVSIQEFRDLWKQLMFYQEVFHKQD
TNRSGSLNWAQLRAAMREAGIMLSDDVCQLMLIRYGGPDLQMNFVRFVRLMLRVENMEDV
FQNLTQDGKGIYLQKPEWLMMALYC
Download sequence
Identical sequences F1MB09
NP_001179354.1.59421 NP_001179354.1.76553 ENSBTAP00000021091 ENSBTAP00000021091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]