SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021095 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021095
Domain Number 1 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 351-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 155-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 412-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021095   Gene: ENSBTAG00000000195   Transcript: ENSBTAT00000021095
Sequence length 465
Comment pep:known chromosome:UMD3.1:18:64807707:64812263:1 gene:ENSBTAG00000000195 transcript:ENSBTAT00000021095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSLGPVTFEDVAVYFSQEEWRILDETQRRLYSYVMLETFALVASLGLASSRSYVVVPL
ELGGEPWVQDRVDMTPGTARGAQSGPGLGCWQRAEMKEKTSEQNASVEVPQTRIVHTTKK
SFPCQEPGKDFPVSSDLLQYQVTPQGDTECVEASHNGLRPYKCSACGKTFCRKYRLAEHQ
RVHTGERPYECSECGKTFSYKHILVQHRRVHTGERPFKCRECGKAFSNRPTLARHRRIHT
GEKPYECSECGKLFSQSSSLNEHQRIHTGSRPYKCNECGKFFTSNSNLVKHRRVHTGTKP
YECSECGKFFNQSPSLIKHQRIHTGERPYECSECGKLFSQSCTLIKHQRVHTGARPYKCT
ECGKLFSQSFGLTQHQRIHTGERPYECTECGELFSQSTQLTQHRKIHTRAGPLECGRCGE
VFSQRSTLIEHQKHHSPDRPYECSECKKAFSRRSSLLRHQKVHAG
Download sequence
Identical sequences F1MB05
ENSBTAP00000021095 ENSBTAP00000021095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]