SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021254 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021254
Domain Number 1 Region: 98-186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000226
Family Spectrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021254   Gene: ENSBTAG00000015977   Transcript: ENSBTAT00000021254
Sequence length 207
Comment pep:known chromosome:UMD3.1:3:28665527:28671398:1 gene:ENSBTAG00000015977 transcript:ENSBTAT00000021254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
IKDMSKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AADAEPVLKAHQSHSAEIENQIDRICEMGEVMRKAVQMDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKESSVDTASQGIK
Download sequence
Identical sequences Q0VCF3
NP_001068749.1.59421 NP_001068749.1.76553 XP_010829053.1.44457 XP_019812311.1.53367 9913.ENSBTAP00000021254 ENSBTAP00000021254 ENSBTAP00000021254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]