SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021328 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021328
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 4.15e-42
Family Calmodulin-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021328   Gene: ENSBTAG00000016024   Transcript: ENSBTAT00000021328
Sequence length 172
Comment pep:known chromosome:UMD3.1:24:37820258:37829300:1 gene:ENSBTAG00000016024 transcript:ENSBTAT00000021328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A0N8EUW3 A0A1S3G3L1 A0A1U7V5F2 A0A250YB37 A0A2K5R2Z1 A0A2K6FIN9 A0A2K6SCB8 D2HXK5 E2QY85 F2Z5V6 F6YAZ9 F7HDB1 G3T7V0 G3W9Q9 I3M6T0 M3WYN7 M3Y117 Q5E9E2 T0NNH3 W5PKY9
NP_001015640.1.59421 NP_001015640.1.76553 NP_001231180.1.46622 XP_001363866.1.35504 XP_001493066.1.31192 XP_003406420.1.64505 XP_003435049.1.84170 XP_003924859.1.74449 XP_003995089.1.62641 XP_004275976.1.21590 XP_004313161.1.83887 XP_004388985.1.4749 XP_004412404.1.74151 XP_004662708.1.11716 XP_004742838.1.14098 XP_004853247.1.39548 XP_005224259.1.76553 XP_005337174.1.77405 XP_005697132.1.57651 XP_005868804.1.60319 XP_005893710.1.15283 XP_005974124.1.78601 XP_006071914.1.26621 XP_006146550.1.99106 XP_006727832.1.47382 XP_006761923.1.95426 XP_006920119.1.64745 XP_007089552.1.5354 XP_007126814.1.24612 XP_007191665.1.59432 XP_007456623.1.90284 XP_007933603.1.48129 XP_008072946.1.4292 XP_008072947.1.4292 XP_008532020.1.77740 XP_008578508.1.73410 XP_008688526.1.72690 XP_008977812.1.60252 XP_010831017.1.44457 XP_010956382.1.22495 XP_010974767.1.51371 XP_011233444.1.58354 XP_011378037.1.92234 XP_012302251.1.9421 XP_012396980.1.9362 XP_012396981.1.9362 XP_012507568.1.63892 XP_012507569.1.63892 XP_012581359.1.23501 XP_012786956.1.84141 XP_012882632.1.60039 XP_014333022.1.15283 XP_014333023.1.15283 XP_014422836.1.101512 XP_014635763.1.5094 XP_014683752.1.49734 XP_014923934.1.86478 XP_015095457.1.17985 XP_015338009.1.40921 XP_016012526.1.101085 XP_016066973.1.3490 XP_017381565.1.71028 XP_017381568.1.71028 XP_017531870.1.32401 XP_017819392.1.60252 XP_019273914.1.44245 XP_019273915.1.44245 XP_019273916.1.44245 XP_019520668.1.44202 XP_019670608.1.62641 XP_019842173.1.53367 XP_020007387.1.5219 XP_020019282.1.5219 XP_020744244.1.74333 XP_020826355.1.61212 XP_021541716.1.83697 ENSSTOP00000005236 ENSTTRP00000007879 ENSMPUP00000005018 ENSBTAP00000021328 ENSSTOP00000005236 ENSBTAP00000021328 ENSOARP00000011112 ENSTTRP00000007879 ENSOPRP00000008960 ENSCJAP00000023658 ENSSARP00000010393 ENSCAFP00000030757 ENSETEP00000009140 ENSMPUP00000005018 ENSCAFP00000030757 ENSECAP00000007496 ENSSHAP00000012164 ENSLAFP00000009710 ENSCHOP00000004617 9796.ENSECAP00000007496 9823.ENSSSCP00000003998 9913.ENSBTAP00000051212 ENSOPRP00000008960 ENSFCAP00000019477 ENSPVAP00000006817 ENSLAFP00000009710 ENSPVAP00000006817 ENSSARP00000010393 ENSCJAP00000023658 ENSCJAP00000050796 ENSETEP00000009140 ENSCHOP00000004617 ENSECAP00000007496 ENSSSCP00000003998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]