SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021332 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021332
Domain Number 1 Region: 80-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 216-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 118-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021332   Gene: ENSBTAG00000016028   Transcript: ENSBTAT00000021332
Sequence length 282
Comment pep:known chromosome:UMD3.1:3:103983019:103988377:-1 gene:ENSBTAG00000016028 transcript:ENSBTAT00000021332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEKEQSPEQHLPEEGERGNKPWRVDDSKVPDGEKEPGQANPSEAPQGPSPEEPTQEVA
VSAAEPEDLSAHRRPEVDEKPFVCVQCGKTFNNTSNLRTHQRIHTGEKPYQCSECGKSFS
RSSNRIRHERIHLEEKHYKCPNCEQSFRRHADLTTHQQDHLGRRPFRCDLCGKSFGQSSA
LAVHYRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFGAH
QRTHRGEKPYRCTACGKHFSRSSNLIRHQKTHRGEQAGRESS
Download sequence
Identical sequences F1N5Q1
9913.ENSBTAP00000021332 XP_005204830.1.76553 XP_019813248.1.53367 XP_019813249.1.53367 ENSBTAP00000021332 ENSBTAP00000021332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]