SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021394 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021394
Domain Number 1 Region: 346-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000351
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021394   Gene: ENSBTAG00000016074   Transcript: ENSBTAT00000021394
Sequence length 616
Comment pep:known chromosome:UMD3.1:15:43703911:43770016:-1 gene:ENSBTAG00000016074 transcript:ENSBTAT00000021394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGST
AYIQHNSKEDGSAAYVQHVPIPKTTGDSLRLEDGQAVQLEDDSYDQSALQAVQLEDGTTA
YIHHAVQVPQSDTILAIQADGTVAGLHTGDAAIDPDTISALEQYAAKVSIDGSEGVTGSG
IIGENEQEKKMQVYVLQGIGIRVAKESGQPKKKSFKCGWQXEGSLETPAFHITIRACPHP
GNRPARILHAHTGKAFCSLYGLILQIRKHEGDKEYICSKNNVKRNSKASCWLQNHCRCHR
GRKDFKLHMNGLGKLFFPSKVRPSYIQTYSGHREYSCKKSRCGRVFSYAVPYSRIERDLT
REKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLAMHKRTAHND
TEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLIS
QDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGAHSVAMVTAEGTEGQQ
VAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAI
RIASRIQQGETPGLDD
Download sequence
Identical sequences F1N5N1
ENSBTAP00000021394 ENSBTAP00000021394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]