SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021396 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021396
Domain Number 1 Region: 56-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-25
Family KRAB domain (Kruppel-associated box) 0.00071
Further Details:      
 
Domain Number 2 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 504-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 552-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000154
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000228
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 9 Region: 394-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000759
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021396   Gene: ENSBTAG00000016077   Transcript: ENSBTAT00000021396
Sequence length 599
Comment pep:known chromosome:UMD3.1:7:14734733:14747553:1 gene:ENSBTAG00000016077 transcript:ENSBTAT00000021396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGLAPTCAMPSQEPAYIHESEVPLSSKDHSCPQDVDLFACNGLEPHTSTSVEPSQES
VTFQDVAVDFTEKEWPLLDSTQRKLYKDVMLENYSNLASVGCQVGKPSLISHLEQEEELR
TEDRELHRGPCPDWAMPSKTKWSILMEDIFGKETSNGVTVENSQLGEESAEYTNLFDVFS
IGAHLTQQMGRHTGKRPYHHRDCGVTFRNRSHVTQHVSIYNGRKMHECHQCQKAFTTSAS
LTRHRRIHTGEKPYECNACGKAFNDPSALRSHSRTHLTEKPFDCTQCGNAFRTLSSLKIH
MRVHTGERPYKCDECGKAYGRSCHLIAHRRTHTGERPYECHDCGKAFQHPSHLKEHVRNH
TGEKPYECTQCGKAFRWKSNFNLHKKNHTVEKTYECKECGKSFGDLLSRRKHMRIHIVKK
PVECRQCGKAFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYEC
AACGKVFGDYLSRRRHMSIHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCG
KAFSIGSNLNVHRRIHTGEKPYECLACGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ
Download sequence
Identical sequences E1BAK2
ENSBTAP00000021396 ENSBTAP00000021396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]