SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021549 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021549
Domain Number 1 Region: 43-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-38
Family SCAN domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 483-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 541-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 372-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 430-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 333-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 135-188
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000445
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021549   Gene: ENSBTAG00000016190   Transcript: ENSBTAT00000021549
Sequence length 642
Comment pep:known chromosome:UMD3.1:25:37450949:37463897:1 gene:ENSBTAG00000016190 transcript:ENSBTAT00000021549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSWTASQSTIAPPALGDGLWTVKVEEDSFGSGESDRPWDCPDPETFRCHFRQFRYQEV
AGPEEALSRLRELCCRWLRPEVHSKEQILELLVLEQFLTILPQEIQAWVRKHCPQSGEEA
AAVVRSLQRQPAGTSRQGLVTVRDVAVSLTWEEWERLYPAQKHFFRESAPKDHGNAVSPS
SETRIVNKELIPKQEILEVELQGQLQGFQEKAPLSSECGDAQDRREKSLGDPSSLKRENS
PEDQGVTHISDLRNGPSEEGDVKNKEFRTSAESSDFVAGQYVPTAGRPATGDEYGNNCQH
RLDMVKPHESLNSEENRHHSGLFETQRWFHEERPYTCDTCEKSFKQRSDLLKHHRIHTGE
RPYGCSVCGRRFSQSATLIKHQRTHTGEKPYTCPRCGDSFRQSSNLSRHQRTHLGEKHYT
CNNFRETCHTSSHFSHQRTHNEERPYLCEECDKSFKRCSDLSKHQRIHTGEKPYGCPVCG
RRFSQSATLIKHQRTHTGEKPYTCPKCGDSFRQSSHLSRHQRTHLGEKHYTCKECGENCR
TSSRFRHQRTHKAERPHTCEECNKSFKRSSDLSKHQRIHTGEKPYGCSVCGKHFSQSATL
IKHRRTHTGEKPYRCLDCGGSFRQSSHLVRHQRIHRNKVPSF
Download sequence
Identical sequences Q3SYX4
NP_001071423.1.59421 NP_001071423.1.76553 ENSBTAP00000021549 ENSBTAP00000021549 9913.ENSBTAP00000009129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]