SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021593 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021593
Domain Number 1 Region: 157-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000263
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 190-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000942
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021593   Gene: ENSBTAG00000016229   Transcript: ENSBTAT00000021593
Sequence length 244
Comment pep:known chromosome:UMD3.1:8:46883356:46907760:-1 gene:ENSBTAG00000016229 transcript:ENSBTAT00000021593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAYMDFVAAQCLVSISNRAAVPEHGGAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANPL
Download sequence
Identical sequences A0A286XTY5 A0A2I2U6Q9 C7EMF2 E1B7V1 L5K6A3 L8IFY6 P79288
ENSSSCP00000023475 ENSBTAP00000021593 NP_001011504.1.46622 NP_001180143.1.59421 NP_001180143.1.76553 XP_003472252.1.53824 XP_003995458.2.62641 XP_004276456.1.21590 XP_004315809.2.83887 XP_004440686.1.5094 XP_004838219.1.39548 XP_005897536.1.15283 XP_006080679.1.26621 XP_006209456.1.17985 XP_006918471.1.64745 XP_007182311.1.59432 XP_007446118.1.90284 XP_010636766.1.5607 XP_010858937.1.44457 XP_011369593.1.92234 XP_012637720.1.48125 XP_014939479.1.86478 XP_015991004.1.101085 XP_019319167.1.44245 XP_019790267.1.83887 XP_019821613.1.53367 ENSBTAP00000021593 ENSMICP00000000958 10141.ENSCPOP00000004770 9823.ENSSSCP00000005646 9823.ENSSSCP00000005648 9913.ENSBTAP00000021593 ENSMICP00000000958 ENSPVAP00000005639 ENSCPOP00000004770 ENSSSCP00000023475 ENSCPOP00000004770 ENSPVAP00000005639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]