SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021603 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021603
Domain Number 1 Region: 31-572
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 7.06e-140
Family Myeloperoxidase-like 0.000037
Further Details:      
 
Domain Number 2 Region: 806-949
Classification Level Classification E-value
Superfamily EF-hand 7.37e-26
Family Calmodulin-like 0.005
Further Details:      
 
Domain Number 3 Region: 1276-1375
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000719
Family Ferredoxin reductase FAD-binding domain-like 0.011
Further Details:      
 
Domain Number 4 Region: 1385-1541
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000000111
Family Flavohemoglobin, C-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021603   Gene: ENSBTAG00000016234   Transcript: ENSBTAT00000021603
Sequence length 1553
Comment pep:known chromosome:UMD3.1:10:65541112:65558771:1 gene:ENSBTAG00000016234 transcript:ENSBTAT00000021603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRARPEVLVLLGVLLSLLLDPTGGQDSLSLTWEVQRYDGWFNNLRHHERGAAGSRLQRL
VPANYADGVYQALEEPLLPNPRRLSNAATRGSSGRPSGRNRTVLGVFFGYHVLSDLVSVE
KSGCPAEFLNIHIPPGDPVFDRDHSGDVVLPFQRSHWDPETGQSPSNPRDLTNEVTGWLD
GSAIYGSSHSWSDELRSFSGGQLASGPDPAFPRAAQAPLLMWMPPDPTTGRRGPRGLYAF
GAERGNRDPFLQALGLLWFRYHNLWAQKLARRYPLWGDEELFQHARKRVIATYQNIAMYE
WLPSFLQQTPPNYTEYRPFLDPSISPEFLAASEQFFSTMVPPGVYMRNASCHFQMVLNES
FGSSPALRVCNSYWIRENPNLNSSQAVNQLLLGMASQISELEDNIVVEDLRDYWPGPGKF
SRTDYVASSIQRGRDMGLPSYSQALQALGLNTPGNWSDLNPNVDPQVLEATAALYNQDLS
RLELLPGGLLESHGDPGPLFSTIVLDQFVRLRDGDRYWFENSRNGLFSPDEIAEIRSTTL
RDVVVAVTNVDPDTLQPNVFIWQDGAPCPQPQQLTTGDLPPCVPLTEIHYFEGSGPGFGI
TIVALCCLPLVSLLISGVVAYFRGRERKKLQRRGKESVKKEPASDGVSAMEWPGPRERSY
PVTIQLLPDRRLQVVDRRLSVLRTIQLQPPQQVNLILSSNRRCRTLLLKIPKEYDLVLLF
NSQEERGAFVQHLRGFCENWALGLDMAEMSEYELFRKAVTKEQRQRILEIFFRHLFAQVL
DINQVDAGTLLLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS
FREFLDVLVVFMKGSPEDKSRLMFTMYDLDGNGFLSKDEFFTMMRVPPTPRPRSFIEISN
NCLTKTQLAEVVESMFRESGFQDKQELTWEDFHFMLRDHDSELRRTQLCVRGGGGGVGDI
FKPNISSRVSFITRTSEERSCPQGVGLPASKAPELGGPGLKKRFGKKAGVPPPRLYTEAL
QEKMQRGFLAQKLQQYKRFVENYRRHIVCVAVFSAICAGLFVERAYYYAFASPPSGIAQT
TFVGIILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAV
VLAILHSAGHVVNVYIFSVSPLSLLACIFPSVFVNDGSKLPQKFYWWFFQTVPGMTGVLL
LLVLAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIYFLVPAL
IYMGDKLVSLSRKKVEIGVVKAQLLPSGVTHLEFQRPQGFEYKSGQWVRIACLALGTNEY
HPFTLTSAPHEETLSLHIRAAGPWTTRLREIYSLPTGDSCAKYPKLYLDGPFGEGHQEWH
KFEVSVLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIRE
VEENDCQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPF
ERFFNSLQEVHPKVQKIGVFSCGPPGMTKNVEKACQLINQQDQAHFVHHYENF
Download sequence
Identical sequences E1BMS3
ENSBTAP00000021603 ENSBTAP00000021603 9913.ENSBTAP00000021603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]