SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021674 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021674
Domain Number 1 Region: 525-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000366
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021674   Gene: ENSBTAG00000016294   Transcript: ENSBTAT00000021674
Sequence length 849
Comment pep:known chromosome:UMD3.1:13:34524932:34807031:1 gene:ENSBTAG00000016294 transcript:ENSBTAT00000021674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVIQVNDIIMQSSFSVPPKDQGDVSLLPSPVEKLLTQKMLESPGKTTCTGEPNIPPGA
IHSGKGLQNKSQFRTIAPKIAPQVLAPRVLPGPVPSLSDQANPGPSLGSKPLGMPPQNYA
LMQVAGQEGTFSLIALPHVASAQPIQKPRMPLPENLKLPIPRYQPPRPGKGVRKKPELER
GCSKSAQTQAAPPPPEHPEPPHKPNPPKVAPDQAPAALTNRSGHQDPGPPGTSNHGGWTP
PATPALATPEEPSAEQGLQKSSGRAKVPSKKTPRKPSAVASEKPQEPVDATKAILSSPGV
IGNAVQVPSSVPRGKLPILPYSRVKTTQVYRSGATVNTAHVPFPGLRTARDQTPSIPEGF
SAAPQVGDRGPAPPAPGQSPGNSAFCQATKPDLNHKTKLNGETAKRRGRKRKGPDELLTF
QGKRWKCVLSCKDSKARVKSEPQESRDQKPEAVKKYRSIMPKPVPVLPALALPPATLQPP
PPGSLGHMSFDHSLAPNHLDWKEDGQPPKPDSAFRNGFSGLRKTWHKCHVCDHPFPCKQH
LREHTSASPDSRPYSCRLCRKVYKRRGSLSAHVRLHHGDSRPRKLVCCEFCAKVFGHVRV
YFGHLKEVHGVAISTEPSPCEPQPGDLPRTREQTPCEVEGLVDRETKSSLEEDLLMNQND
EAGFQIRCGRCQITAQSLAEIKFHLLSVHGEEIQGQLPEESSPSSGSRPAHGELTKQAAP
FWKRPERRKLLRHHPSAGELCAVPRLKRQLYLHHQNNVETLTKQERAQPGPSEPRGDPQG
PKCPGPQAALPLPQSGFNCVLCVQILGSKEELLLHWERQHKCEDPPKLWTIFSTLSSQGV
VQLSSKTGK
Download sequence
Identical sequences F1N281
ENSBTAP00000021674 ENSBTAP00000021674 NP_001137244.1.59421 NP_001137244.1.76553 XP_005214395.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]