SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021685 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021685
Domain Number 1 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 195-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000173
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 97-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000422
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021685
Domain Number - Region: 61-88
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0482
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021685   Gene: ENSBTAG00000016299   Transcript: ENSBTAT00000021685
Sequence length 314
Comment pep:known chromosome:UMD3.1:18:62371838:62374877:1 gene:ENSBTAG00000016299 transcript:ENSBTAT00000021685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPEPPSPSSAAPEPPSSEPPDVVLVHDDGRPATPPSDLIEIQVVKVTDTTLVPEPP
EPGSLHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHY
SLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGAPRRPPEAAAATPEQRTGAPPERS
EVVLAAAAAGAAVGKPFACRFCAKPFRRSSDMLDHERVHTGERPYHCGVCGKGFTQSSVL
SVHARIHTGERPFRCSLCDRTFNNSSNFRKHQRTHVHGRGRGTLGARWHRGLRGRGAGVG
QGTLLKRGVGRRPE
Download sequence
Identical sequences A5PJI8
ENSBTAP00000021685 ENSBTAP00000021685 NP_001093201.1.59421 NP_001093201.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]