SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021794 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021794
Domain Number 1 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 99-159
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 733-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 677-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 452-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 401-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 9 Region: 775-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000233
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021794   Gene: ENSBTAG00000002055   Transcript: ENSBTAT00000021794
Sequence length 861
Comment pep:known chromosome:UMD3.1:18:64049538:64077509:-1 gene:ENSBTAG00000002055 transcript:ENSBTAT00000021794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRNTAACTRVRSPSPALSAAHASARAPRSPSTGASTRARSPSPARSAPRSRSGPTSKGRR
GAATTGPEDRALPSRDTAALRERGPKQEAAGTGVERQATSQSPLTFGDVAVEFSGEEWAW
LDSAQRSLHRSVMLENYRNLASLGLCLSKPEMISSLEQRKEPWAVKRKSTRGMHPDSQTL
LKTQELPSENNFSEEALSQEVRTERPPEHSVLGEGWAYAAVCEGQPGLVAVTDVATDVSQ
RPDPAGQSFCRSVVWADRHPGTGGRCASEPDLVSLLERRKAPWTVDGELVRAPFSGQQCT
EETQEFLSKQSSFAEVVTDRTSETNVGRSSLRESWDAERLFERELASQETRLGQEAVAHH
NTLSEERVCPYNRPGRWFHLDVSEEGVHRPDSVKKALPPNSVLIKHAGIYTGKKLFRCHE
CKKTFTQSSSLTVHQRIHTGEKPYKCKECGKAFSDGSSFARHQRCHTGKKPYECLDCGKA
FIQNTSLVRHWRYYHTGEKPFDCLDCGKAFSDHIGLNQHRRIHTGEKPYKCEACGKSFRY
GSSLTVHQRIHTGEKPYACEVCRKAFSHHASLTQHQRVHSGEKPFQCKECGKAFRQNIHL
ASHLRIHTGEKPFECADCGKAFSISSQLATHQRIHTGEKPYACKVCSKAFTQKAHLAQHQ
KTHTGEKPYECKECGKAFSQTTHLVQHQRVHTGEKPYKCLQCGKAFGDNSSCTQHQRLHT
GQRPYGCAECGKAFKTKSSLICHRRSHTGEKPYECGACGKAFSHRQSLSVHQRIHSGKKP
YECKECRKAFIQIGHLNQHKRVHSGERPHGPGRSRRAFRQGSHFAHARTHAGDAPAHAAP
VARPADLLPAFLWSPPSLPSL
Download sequence
Identical sequences G5E5J3
ENSBTAP00000021794 ENSBTAP00000021794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]