SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021830 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021830
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-47
Family Dual specificity phosphatase-like 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021830   Gene: ENSBTAG00000016413   Transcript: ENSBTAT00000021830
Sequence length 211
Comment pep:known chromosome:UMD3.1:27:28963365:28969954:-1 gene:ENSBTAG00000016413 transcript:ENSBTAT00000021830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASVTFMARFSRSGSRSPVRVRGALEEPPAVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQEIANNHRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSVHFQAAADFIHRALSQPGGRILVHCAVGVSRSATLVLAYLMLYHRLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences Q17QJ3 W5NQN9
ENSBTAP00000021830 ENSBTAP00000021830 ENSOARP00000000479 NP_001069472.1.59421 NP_001069472.1.76553 XP_010818620.1.76553 XP_020765785.1.74333 9913.ENSBTAP00000021830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]