SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021860 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021860
Domain Number 1 Region: 222-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.09
Further Details:      
 
Domain Number 2 Region: 58-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000518
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021860   Gene: ENSBTAG00000016441   Transcript: ENSBTAT00000021860
Sequence length 470
Comment pep:known chromosome:UMD3.1:20:56767512:56781229:1 gene:ENSBTAG00000016441 transcript:ENSBTAT00000021860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYTCNTCRAVLEDAEAQRVHYKTDWHRYNLRRKVAGMAPVSLEGFQERVRAQRALAEP
ESKGAATYCTVCSKKFASFKAYENHLRSRRHVELEKQAVSRKVALMNEKNLEKGLGVDSV
DKDAVNAAIQQVIKAQPSTSPKKAAPAPEAEPGCPVAAGGRGTQPRDPGEKPPRLRWFER
QAKKLAKQQGEEESEEDLDADDWEDIDSDEDLECEDAEAMEEEEEQDAEEEEAGGSTPLG
AIPITDCLFCPHHSSSLTKNVAHMTKVHSFFIPDVEYLSDLKGLIKYLGEKVGVGKICLW
CNERGKSFYSTEAVQAHMNDRSHCKLFTDGDALLEFADFYDFRSSYPDHKEGEDHDETEE
LPSEKTLDYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYR
ALGWTGSTGAALVRQRDMQYVQRMKSKWMLKMGMKNNATRQMHFRPQVLF
Download sequence
Identical sequences F1N194 L8IGY9
ENSBTAP00000021860 ENSBTAP00000021860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]