SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021869 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021869
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 6.8e-25
Family BTB/POZ domain 0.0037
Further Details:      
 
Domain Number 2 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 826-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000718
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 973-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000783
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 1065-1118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000217
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 6 Region: 802-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000598
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021869   Gene: ENSBTAG00000016448   Transcript: ENSBTAT00000021869
Sequence length 1232
Comment pep:known chromosome:UMD3.1:2:130900401:130937992:-1 gene:ENSBTAG00000016448 transcript:ENSBTAT00000021869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLASLVNCS
VQGQVVRDVSTPSEPSRKESEKPETEILSSEGAGEHHTSPEVSTPPGGPVKVEVKHGVHT
AVQEMRVDPPAAQEIQGHTDTPGSHSAEVCPSAPVVQTFREAKEASTEQEYEGKHYQLNF
LLENEKIFSDALLITQDVLKRLEECSEIKDVQKQTIMGCLEGEGQSAFQRILDKVRSESL
GVQTVVSLLRLYQDSNPAVKTALSDRKLEAVEAVQPKGSTEEGKTLSVLLLEHKEDLIRC
VTQLRPILEFLETVEEEFLPGSEKRVILNCCEGSTPKETIEKLLHRMSEEKTLSAESLVK
LLQAVKMTFPDLGLLLENLQKLATLPSTTAQANPDDYGIELLRRYHENLSEIFTDNQVLL
RMIPHVKSIVPGEKEVMEKLVRRAAGSRAVHALMSAVLEKHTVSAAAIWQLLLVAQETKP
CPLSLLMEEIRREPGANAFFRAVMTPESAAFETILRYHRSILEAIQQTAQLKCLASEEER
LAETAKEILSSSSETASPEASLGALLSRAAEKSISATEICQLLCSIHRSSPGLQPVMREL
ACAGFLTQEKGEKERWTVSGKFYSEGKDKAGEKPAGEDCQPGNQDSQGETAALPEQQEKD
ASTSPDSAKKSFVCKACDKSFHFYCRLKVHTKRCRVARSRQVQCTECNETKDSKKELEKH
QLEAHGAGGEPSIPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECGAK
FAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDAVFAQ
SIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQD
HRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHMVTHVGGKPFSCGICNKAYQQLSGLWYH
NRTHHPDVFAAQNHRSSKFSSLQCSSCDKTFSNTLEHKKHIKTEHADVKFHECDQCKELF
PTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQHHVTTEHFKQSESTFPCELCGELF
TSQAQLDCHLESEHPKVLGAETQSQMVQVIQTPEPVAPMEQVVTLEETQLAGSQVFVTLP
DSQTAQTSSELVAVTVEDLLDGTVTLICGEAK
Download sequence
Identical sequences F1N193
NP_001192990.1.59421 NP_001192990.1.76553 ENSBTAP00000021869 ENSBTAP00000021869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]