SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021929 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021929
Domain Number 1 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 105-167
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 371-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000732
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 301-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000294
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021929   Gene: ENSBTAG00000016496   Transcript: ENSBTAT00000021929
Sequence length 439
Comment pep:known chromosome:UMD3.1:5:32100937:32106571:1 gene:ENSBTAG00000016496 transcript:ENSBTAT00000021929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQNDRLSQFGFAAKMLSEQTAALGTGWESMNVQVDRAEPQVERGSQEEGPWRTAPGPLE
HLCCDLEEEPQSLQEKAQSTPWVPAIPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFS
QEEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPPDLEER
DILKVTYTGDGSEHEGDTPELEAEPPRMLSSVSQDTVLWNPEQDANWDSMPRSSRGMLLG
PPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEK
SFGRRHHLIRHQKTHLHDKPSRCPECGKNFRCNSHLASHQRVHADGKSCKGQEVGESPGA
RKRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHL
LTHQGQSPRSSWDRGTSVF
Download sequence
Identical sequences E1BNN9
ENSBTAP00000021929 ENSBTAP00000021929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]