SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021985 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000021985
Domain Number - Region: 168-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00548
Family Plant C2H2 finger (QALGGH zinc finger) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021985   Gene: ENSBTAG00000016534   Transcript: ENSBTAT00000021985
Sequence length 243
Comment pep:known chromosome:UMD3.1:11:43071977:43174031:-1 gene:ENSBTAG00000016534 transcript:ENSBTAT00000021985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDI
LIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGI
CPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFT
SAWFLLQHAQNTHGLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAREPLSS
EKI
Download sequence
Identical sequences A0A0D9RPI3 A0A0P6JET3 A0A1S3FN22 A0A2J8N3H8 A0A2J8XCJ1 F6TKM3 F6UND0 K9IWX9 M3Y1C2 Q17QR0 W5NUA5
ENSMPUP00000005123 ENSBTAP00000021985 ENSDNOP00000028985 ENSP00000352648 gi|20336313|ref|NP_612569.1| ENSNLEP00000011549 ENSP00000352648 ENSOARP00000001749 9823.ENSSSCP00000008956 9913.ENSBTAP00000021985 ENSECAP00000006222 NP_001069589.1.59421 NP_001069589.1.76553 NP_612569.1.87134 NP_612569.1.92137 XP_003262466.1.23891 XP_003309073.1.37143 XP_003775966.1.23681 XP_004029327.1.27298 XP_004397769.1.74151 XP_004435719.1.5094 XP_004636241.1.9945 XP_005575868.1.63531 XP_005890558.1.15283 XP_005955004.1.78601 XP_006073949.1.26621 XP_006191387.1.101512 XP_006747508.1.47382 XP_006868089.1.41390 XP_007968730.1.81039 XP_008954530.1.60992 XP_010375929.1.97406 XP_010861248.1.44457 XP_010950189.1.22495 XP_011711622.1.29376 XP_011894890.1.92194 XP_011966599.1.54773 XP_012385259.1.11602 XP_012494684.1.63892 XP_012620279.1.48125 XP_012620280.1.48125 XP_012659463.1.62490 XP_012877958.1.60039 XP_012906533.1.14098 XP_012921912.1.39548 XP_013851574.1.46622 XP_014967930.1.72884 XP_015335131.1.40921 XP_015985146.1.101085 XP_017522151.1.32401 XP_017910768.1.57651 XP_019486725.1.44202 XP_019572867.1.88060 XP_019825758.1.53367 XP_020764712.1.74333 XP_020941361.1.46622 XP_021554938.1.83697 ENSMMUP00000014826 ENSGGOP00000023481 ENSMPUP00000005123 ENSBTAP00000021985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]