SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021993 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021993
Domain Number 1 Region: 461-544
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-29
Family Forkhead DNA-binding domain 0.0000145
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021993
Domain Number - Region: 305-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0173
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021993   Gene: ENSBTAG00000016533   Transcript: ENSBTAT00000021993
Sequence length 674
Comment pep:known chromosome:UMD3.1:22:30411677:30803681:1 gene:ENSBTAG00000016533 transcript:ENSBTAT00000021993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQESGTETKSNGSAIQNGSSGGNHLLECGSLREGRSNGETPAVDVGTADLAHVQQQQQA
LQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVL
SPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQHAGKQPKEQQQVATQQLAFQ
QQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLTQGMIPTELQQLWKEVTSAHTTE
ETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPL
YGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKERL
QAMMTHLHVKSTEPKTAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPITPATQGPS
VITTTSMHTVGPIRRRYSDKYNVPISSDIAQNQEFYKNAEVRPPFTYASLIRQAILESPE
KQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQK
RRPQKISGNPSLIKNMQTSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIR
EELNGAMEHTNSNESDSSPGRSPLQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDH
DRDYEDEPVNEDME
Download sequence
Identical sequences A4IFD2
9913.ENSBTAP00000021993 ENSBTAP00000021993 NP_001077158.1.59421 NP_001077158.1.76553 XP_005222715.1.76553 XP_014338511.1.15283 XP_019839986.1.53367 ENSBTAP00000021993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]