SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022028 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022028
Domain Number 1 Region: 175-559
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.98e-164
Family Myotubularin-like phosphatases 0.000000000000573
Further Details:      
 
Domain Number 2 Region: 49-172
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-44
Family GRAM domain 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022028   Gene: ENSBTAG00000016557   Transcript: ENSBTAT00000022028
Sequence length 617
Comment pep:known chromosome:UMD3.1:15:14640226:14707505:1 gene:ENSBTAG00000016557 transcript:ENSBTAT00000022028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTSHSENSVHTKSASVVSSDSISTSAENFSPDLRVLRESNKLAEMEEPPLLPGENIKD
MAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVISRVEKIGGASSRGE
NSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLSLFAFEYKEVFPENGW
KLYDSLSEYRRQGIPNESWRITKVNERYELCDTYPALLVVPANIPDEELKRVASFRSRGR
IPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVN
AVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLEST
HWLEHIKLILAGALRIADRVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFE
VLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLI
TILDHLYSCLFGTFLCNSEQQRGKENLPRRTVSLWSYINSQLEDFTNPLYGSYSNHVLYP
VASMRHLELWVGYYVRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSS
ERAGSPAQCVTPVQTVV
Download sequence
Identical sequences F1MMI7
ENSBTAP00000022028 ENSBTAP00000022028 9913.ENSBTAP00000022028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]