SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022129 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022129
Domain Number 1 Region: 165-195
Classification Level Classification E-value
Superfamily WW domain 0.000000000426
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 124-156
Classification Level Classification E-value
Superfamily WW domain 0.00000000154
Family WW domain 0.00029
Further Details:      
 
Domain Number 3 Region: 9-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000208
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022129   Gene: ENSBTAG00000016637   Transcript: ENSBTAT00000022129
Sequence length 395
Comment pep:known chromosome:UMD3.1:12:11306594:11329117:1 gene:ENSBTAG00000016637 transcript:ENSBTAT00000022129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSIEFHERGKNHKENVAKRISEIKQKSLEKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEISEPSVSPVTSTVPPTSASNQQKEKKKKKKDP
SKGRWVEGITSEGHHYYYDLITGASQWEKPEGFQGNLKKATGKTVWIEGLSEDGYTYYYN
TETGESRWEKPDDFIPHSGDLPSSKVNEKSLGTLEESKSSDSHGESDGEQEAGKEKKKEE
IPTETQKLIIKFKEKNKNSNKRTEPETQKEKNTQGKNSSGPSEEKPKEKNTQGKSSSGSN
EEKPKAHKKPNPYGEWQEIKPEVESHEEVDLELPSAENEYVSTSEADAAGEPQLVFKEKT
VTSLGVVADGVAPVFKKRRIENGKSRNLRQRGDDQ
Download sequence
Identical sequences Q17QQ6
ENSBTAP00000022129 ENSBTAP00000022129 NP_001068719.1.59421 NP_001068719.1.76553 9913.ENSBTAP00000022129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]