SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022161 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000022161
Domain Number - Region: 138-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00191
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022161   Gene: ENSBTAG00000016664   Transcript: ENSBTAT00000022161
Sequence length 319
Comment pep:known chromosome:UMD3.1:13:54502134:54505099:-1 gene:ENSBTAG00000016664 transcript:ENSBTAT00000022161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEFALPQEPEPRAADLGAPGAGAAGPPTPSAHIPVPAHRTPPGKARLDEVMAATALTSLS
TSPLLLGAPGVTFSTEPCLEPWREAPVQPPGSGGGWDPASDQSSPSTPSPPLPPEAAHFL
FGESALRKRKSSLQGLFQCLWKRCGKVLSSASGMQRHIRLVHLGRQAELEQSDGEEDFYY
TELDSGMDSLTDGLSGLTPGSPTASVPPAFPHLEPLEPLALPSLLRLPAMPPPPVLSTTS
PSQVCPSDHAHQGCLAPVRLEPQPTPVRACVPALPAKPSANPRKPRGDAKKCRKVYGMDH
RDLWCTACRWKKACQRFLD
Download sequence
Identical sequences F1ML80
ENSBTAP00000022161 9913.ENSBTAP00000022161 ENSBTAP00000022161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]