SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022223 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022223
Domain Number 1 Region: 614-713
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000763
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022223   Gene: ENSBTAG00000016717   Transcript: ENSBTAT00000022223
Sequence length 750
Comment pep:known chromosome:UMD3.1:11:63413128:63424655:1 gene:ENSBTAG00000016717 transcript:ENSBTAT00000022223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGAEKAEGEASSDTKAPSCGSWSRGEQELIPVGPVLGEQPPRLEAEGGPASPVEGTEG
LPGPACYGGVGPGPSRACQPPASGASREPAAGGSKPAFGCVPSAGLETGDLPSAGSQMEE
TRLPAPEALPQTHAIPRAAALCLGHDADTEDDPSPVESPQVPDLCPQSPISGFPCPSRWR
SAVSPGTPAPPSSSCSMSASSPGSSLQGHQEKAEPRSGCLAKVSSSLELAVPPSAPSVVS
PGPRLQWLPQPVSSAGDASGLGRRRLSFQAEYWACVLPDSLPPSPDRRSPLWNPNKEYED
LLDYTYPLRPGPRLPKQLDSHVLAEPVLQDSGIDLDSFSVSPASTLKSPTNVSHSCPPAE
AAALSFSGPREPSLKRGPSGVPQKQGGVGLASCSLFASTPRAPSGRATPWVSREPARRNL
RDWPPVGRHLELGSPRLRTRDKGWSSPGLEREKGASQGLRRLTCEESGWKPQEEVESDDE
YLALPTRLTQVSSVISYLGSIPTLVPLSTDAAEGQSSLDVSDSDGPASLPSDSSQSQLPS
GATLRGSWSAEDQKHCLRRSFVHARRSAREGSLVSSQALGVSSGPVRTRASWSAVLDPDA
EGQPPRKGGEQGKESLVQCVQTFCCQLEELIHWLYNVADTTDHLTAPRSNLTGLKSSLQL
YRQFKKDIDEHQSLTESVLQKGEILLQSLLDNTPVLKDVLGRISRQPSALESHADRLYDT
ILASLDTLAGCTLTPDSTPAAHRSTGVKGI
Download sequence
Identical sequences E1BPP3
ENSBTAP00000022223 9913.ENSBTAP00000022223 ENSBTAP00000022223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]