SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022231 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022231
Domain Number 1 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.74e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000342
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022231   Gene: ENSBTAG00000016723   Transcript: ENSBTAT00000022231
Sequence length 420
Comment pep:known chromosome:UMD3.1:3:51104164:51112405:1 gene:ENSBTAG00000016723 transcript:ENSBTAT00000022231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVLAPGGADGISSTGGAKAELRGRVSPESQ
LTEAPDRASASPGSCEGSVCDRSSEFEDFWRPPSPSVSPASEKSVCPSLDEAQPFPLPFK
PYSWSGLAGSDLRHLVQSYRPCAALERGAGLGLFCERAPEPGHPAALYGPERAAGGAGAG
APGGGSAGGGTAGGAGLGLFGDFGPAAAGLYERPATGGLYPERGHGLHGDKGTGVKVESE
LLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEICGKTFGHAVSLEQH
KAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIH
TGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK
Download sequence
Identical sequences F1MPJ9
ENSBTAP00000022231 NP_001178241.1.59421 NP_001178241.1.76553 XP_005204309.1.76553 XP_010801592.1.76553 ENSBTAP00000022231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]