SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022287 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022287
Domain Number 1 Region: 31-120
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.83e-38
Family SCAN domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 268-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022287   Gene: ENSBTAG00000030956   Transcript: ENSBTAT00000022287
Sequence length 466
Comment pep:known chromosome:UMD3.1:25:36924066:36931834:-1 gene:ENSBTAG00000030956 transcript:ENSBTAT00000022287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVLGPRPPQEQGPVIVKIEEEEEKGKRLPMEIFRQRFRQFGYHDTPGPREALSQLRVL
CCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLLEDLERELDE
PAPQVSPPPREQKRSWEKMSPSGMAEESLSSPQLESVETSHRYESWGPLYIQETGEEEKF
TPALRKVRDRKSKTQNEESTDKEGSSEESHAEGFRRDTLPMIITDKCEARLERQWVNPEK
ERGTKTPLQDKGSAKGREVVTKPAPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVC
TKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGK
AFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNH
SSNFNKHHRIHTGEKPYWCSDCGKTFCSKSNLSKHQKVHIVEGEGS
Download sequence
Identical sequences Q3ZBY5
NP_001030445.1.59421 NP_001030445.1.76553 ENSBTAP00000022287 ENSBTAP00000022287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]