SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022760 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022760
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 448-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 389-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 501-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 351-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 297-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000319
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022760   Gene: ENSBTAG00000017123   Transcript: ENSBTAT00000022760
Sequence length 611
Comment pep:known chromosome:UMD3.1:7:3419014:3443864:1 gene:ENSBTAG00000017123 transcript:ENSBTAT00000022760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQREARSQVSVTFEDVAVLFTRDEWRKLAPSQRNLYQDVMLENYSNLVSLGLPFSKP
EVISLLQQGEDPWKVEKESPGDSSLECKSSPKTTKATQTQDSSFSGLIRKTLKKDEPWNF
ISENPCIYEDRIKKQKDKSESLQIISVTHTKILTVERSHKNNDFGQNFSLKSVFVKQQRI
AREKTPSKYEIQRNSLRQDSNVLNQSKIKTAEKRHKCNICEKAFIHKSSLRKHQKNHTGE
RLFQCDECLKAFNQSSALIQHQRTHTGEKPYICKECGKAFSHSASLYKHVKIHTVEKSYK
CKECGKSFGRRSALFIHQKIHAQDNPHKYNPGRKASTCNLPGCQRIHPRKKSYLCNECGN
TFKSSSSLRYHQRIHTGEKPFKCGECGRAFSQSASLIQHERIHTGEKPYRCNECEKGFTS
ISRLNRHRIIHTGEKLYNCNECGKALSSHSTLIIHQRIHTGEKPCKCKVCGKAFRQSSAL
IQHQRMHTGERPYKCNECGKTFRCNSSLSNHHRIHTGEKPYRCLECGISFGQSAALLQHQ
RIHTGEKPFVCITCGKTFRQSSSLIAHQRIHTGEKPYECNACGKLFSQRSSLTNHYKIHI
EEDPFKVDLHV
Download sequence
Identical sequences F1MEQ1
XP_005208467.1.76553 XP_005208468.1.76553 XP_006080409.1.26621 XP_006080410.1.26621 XP_006080411.1.26621 XP_015319414.1.59421 XP_015319415.1.59421 ENSBTAP00000022760 ENSBTAP00000022760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]