SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022819 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022819
Domain Number 1 Region: 176-284
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000497
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 31-89,148-173
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000942
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022819   Gene: ENSBTAG00000017160   Transcript: ENSBTAT00000022819
Sequence length 293
Comment pep:known chromosome:UMD3.1:23:43001022:43024073:1 gene:ENSBTAG00000017160 transcript:ENSBTAT00000022819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDIEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHVQVMTYRKEQYSDVLHALKVIRFVSDATPQSEVYLYMHRLESGKLP
RSPSFPLEPEDEVFLAIAKAMEEMVEDSVDCYWIMRCFVNQLNSKYRDTLPQLPKAFEQY
LNLEDSRLLSHLKACCAVSTLPYELWFKKCFAGCLPESSLQRIWDKVVSGSCKILVFVAV
EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSA
Download sequence
Identical sequences Q5E9C4
ENSBTAP00000022819 9913.ENSBTAP00000022819 ENSBTAP00000022819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]