SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022833 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022833
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily POZ domain 9.03e-22
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000211
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 484-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000707
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022833   Gene: ENSBTAG00000017184   Transcript: ENSBTAT00000022833
Sequence length 665
Comment pep:known chromosome:UMD3.1:X:5043334:5050947:-1 gene:ENSBTAG00000017184 transcript:ENSBTAT00000022833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGTAQDGNAENSPPEIQKSKDESQENGATIMPIITESFSLSAEDYETKKIIVTD
SDDDDDDVIFCSEILPAKETLPSTNTVAEVQPNPGSVAISDDAPCVSNSSPPLTNITPTQ
KLPTSVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLTTPPNVSSSLPNHMSPSIN
LLVQNQQPPNSAVLPGNKANEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQAEIPPNTTF
DGSLIQKMQIPTLLQEPVSNSLKISDIITRNTNDPGLGSKHLMEGQKIITLDTATEIEGL
STGCKVYANIGEDTYDIVIPVKDDPDEGEARLGNEIPKTPSSETANKRMKVKHDDHYELI
VDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGE
RRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGTM
PVMKDDGIGYKVDAGKEPPVGTTSAPQNKPMTWEDIFIQQENDSMFKQNVTDGSTEFEFI
IPESY
Download sequence
Identical sequences A5D7M1
9913.ENSBTAP00000022833 ENSBTAP00000022833 NP_001091626.1.59421 NP_001091626.1.76553 ENSBTAP00000022833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]